PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g003230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 554aa    MW: 60846.3 Da    PI: 4.5754
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g003230.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS446.42e-1361855441374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAea+++++l+la+al++r+ +la++++ +m ++a+yf++ALa+r++r           ++++  ++s     +  f+e +P+lkf+h
  Csa15g003230.1 185 LVHALVACAEAIQQDNLTLADALVKRVGTLAASQAGAMGKVATYFAQALARRIYR---------GYTADT--DVSFDDVLQMHFYESCPYLKFAH 268
                     689****************************************************.........223333..34444444456************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIleav++++rvH+iD++++qG+QWpaL+qaLa Rp+gpp +R+Tgvg+p+++++++l+++g+rLa+fA++lgv+fef+ l+a++l+dle
  Csa15g003230.1 269 FTANQAILEAVATSRRVHVIDLGLNQGMQWPALMQALALRPGGPPLFRLTGVGPPQKENSDSLQQLGWRLAQFAQNLGVEFEFKGLAAESLSDLE 363
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     +e+++++p  E+l+Vn+v++lhrll++s+s+e+    +L +vk ++P +v+vveqea+hn+  Fl+rf eal+yys+lfdsle +++  s++r+ 
  Csa15g003230.1 364 PEMFETRPeSETLVVNSVFELHRLLARSGSIEK----LLGTVKAIKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLEDSYSLPSQDRA- 453
                     ********9************************....************************************************988887776. PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++++lgr+i nvva+eg++r+erhetl +W +r+++ GF pv+l+++  kqa+ ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  Csa15g003230.1 454 MSEVYLGRQILNVVAAEGTDRVERHETLPQWTNRMKTGGFDPVHLGSSGFKQASILLSVFAaGDGYRVEEKDGCLMLGWQTRPLITTSAWK 544
                     56677*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120412.8E-3442108IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011295.7E-4042114No hitNo description
PROSITE profilePS5098566.524159523IPR005202Transcription factor GRAS
PfamPF035146.9E-134185544IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MKRGHGETWD PPPPSREGPS MVDKKMAAAD DNNNNNSNNM DDELLAVLGY KVRSSEMAEV  60
AQKLEQLEMV LSNDDVGSST LLNDTVHYNP SDLSNWVESM LSELNNPASS DLDPTTGGCV  120
VDRSEYDLRA IPGLSAFPKQ EEEEVFDVEE EASSKRIRLG SYCESTGEST RPVVLVDSQE  180
TGVRLVHALV ACAEAIQQDN LTLADALVKR VGTLAASQAG AMGKVATYFA QALARRIYRG  240
YTADTDVSFD DVLQMHFYES CPYLKFAHFT ANQAILEAVA TSRRVHVIDL GLNQGMQWPA  300
LMQALALRPG GPPLFRLTGV GPPQKENSDS LQQLGWRLAQ FAQNLGVEFE FKGLAAESLS  360
DLEPEMFETR PESETLVVNS VFELHRLLAR SGSIEKLLGT VKAIKPSIVT VVEQEANHNG  420
VVFLDRFNEA LHYYSSLFDS LEDSYSLPSQ DRAMSEVYLG RQILNVVAAE GTDRVERHET  480
LPQWTNRMKT GGFDPVHLGS SGFKQASILL SVFAAGDGYR VEEKDGCLML GWQTRPLITT  540
SAWKLAGAAE SRR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-611855444375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ1777590.0GQ177759.1 Arabidopsis thaliana ecotype Cvi-0 RGL2 gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010463795.10.0PREDICTED: DELLA protein RGL2-like
SwissprotQ8GXW10.0RGL2_ARATH; DELLA protein RGL2
TrEMBLD7L0H60.0D7L0H6_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.3__292__AT3G03450.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.10.0RGA-like 2